PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G1317
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 429aa    MW: 46153.1 Da    PI: 5.7572
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G1317genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.82.7e-14214270359
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                  + kr+rr+ +NRe+ArrsR+RK+a++ eLe  v +L  e ++L k+l +++ ++++ 
  Gh_D11G1317 214 DAKRARRMRSNRESARRSRRRKQAQLNELEAQVGQLRVEHSTLLKRLTNMNHKYDEA 270
                  68******************************************9999998888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.1E-10211266No hitNo description
SMARTSM003382.7E-16212276IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.047214269IPR004827Basic-leucine zipper domain
PfamPF001701.1E-11215268IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.93E-9216266No hitNo description
PROSITE patternPS000360219234IPR004827Basic-leucine zipper domain
PfamPF124983.1E-25283403IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MNTVFSVDDF SDSFWAAPAS DDALGMTRSH SEWALERLLE EFSGAGVAIS GSHAGENVIG  60
PSLMAPQSSV SKVEEGDVVE IKTPNSQNHN HPPSDQTPTV PTASDDYHTI LKSKLELECA  120
VVALSRALAV KAEDSSAEAE NHGLPSGSKV QGSSKVQGQG ETDVAHCGTL TGSTTQKKSG  180
VQVRQATSGS SREDSDSDEL EGDTETADNM DPADAKRARR MRSNRESARR SRRRKQAQLN  240
ELEAQVGQLR VEHSTLLKRL TNMNHKYDEA AVDNRIMKAD IETLRAKVKM AEETVKRVTG  300
FNPALLSRPN VPSVGMPFVS NPSESSAVAP LPFQSNANQF FNQPVPNIVA SIHHQRVDNS  360
FRGNTLVPPD VNSQTKGVKN VNETSVLQHG PSLDCVPDQI GPGVSPCGPM PGWEPGLLPD  420
AGDRNHKQC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228235RRSRRRKQ
2230235SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.9960.0boll| ovule| root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5773032e-35JX577303.1 Gossypium hirsutum clone NBRI_GE9096 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490636.10.0PREDICTED: basic leucine zipper 25 isoform X1
SwissprotQ9M1G61e-72BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A0D2QSI10.0A0A0D2QSI1_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.14e-66basic leucine zipper 25